Pinterest

Today
Watch
Shop
Explore
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.

Apple salad

Discover Pinterest’s 10 best ideas and inspiration for Apple salad. Get inspired and try out new things.
Amazing Honeycrisp Salad
Saved from fivehearthome.com

Amazing Honeycrisp Salad

This gorgeous Holiday Honeycrisp Salad boasts sweet apples, dried fruit, cheese, & nuts for a delicious Christmas salad or Thanksgiving salad!

Autumn Salad Recipes
Lettuce Salad Recipes
Apple Salad Recipes
Fresh Salad Recipes
Side Salad Recipes
Salad Recipes For Dinner
Dinner Salads
Healthy Salad Recipes
Delicious Salads
Sue Weeks
Sue Weeks saved to food
Apple Fruit Salad (with Creamy Cinnamon Dressing) - Cooking Classy
Saved from cookingclassy.com

Apple Fruit Salad (with Creamy Cinnamon Dressing) - Cooking Classy

Apple Fruit Salad - The perfect autumn fruit salad! It's loaded with crisp, sweet apples, cranberries and walnuts and covered in a rich, cinnamon cream cheese dressing.

Apple Fruit Salad Recipe
Easy Fruit Salad Recipes
Salad With Fruit
Creamy Fruit Salads
Best Fruit Salad
Fruit Fruit
Veggie Salad
Healthy Fruits
Healthy Snacks
Fran MatsuokaF
Fran Matsuoka saved to Recipes
Apple Cranberry Walnut Salad
Saved from lecremedelacrumb.com

Apple Cranberry Walnut Salad

This Apple Cranberry Walnut Salad features crisp apples, dried cranberries, feta cheese, and hearty walnuts to create the perfect salad!

Apple Salad Recipes
Healthy Salad Recipes
Delicious Salads
Vegetarian Recipes
Cooking Recipes
Autumn Salad Recipes
Christmas Salad Recipes
Spinach Apple Salad
Cranberry Salad Recipes
Julie Klegraefe
Julie Klegraefe saved to Salads
Ruby Tuesday apple salad is crisp, delicious, and bursting with fresh flavors. It's so easy to make at home, you don't have to go out for this great lunch or dinner recipe.
Saved from cookcleanrepeat.com

Ruby Tuesday Apple Salad

Ruby Tuesday apple salad is crisp, delicious, and bursting with fresh flavors. It's so easy to make at home, you don't have to go out for this great lunch or dinner recipe.

Ruby Tuesday Apple Salad Recipe
Ruby Tuesday Recipes
Apple Salad Recipes
Pasta Salad Recipes
Apple Salad Recipe Healthy
Cookie Salad
Restaurant Recipes
Dinner Recipes
Baked Potato Salad
Rita Bellinger
Rita Bellinger saved to Favorite Recipes
Snickers Salad (Snicker Apple Salad) | Mom On Timeout
Saved from momontimeout.com

Snickers Salad (Snicker Apple Salad) | Mom On Timeout

This easy Snickers Salad is a sweet and tart creamy dessert salad that is perfect for potlucks, parties and holidays! Ready in just minutes!

Sweet Recipes
New Recipes
Favorite Recipes
Healthy Recipes
Fall Treats Recipes
Fall Favorites Recipes
Jello Recipes
Unique Recipes
Summer Recipes
Shayla Lewis
Shayla Lewis saved to Things To Try
Apple Waldorf Salad
Saved from organizedisland.com

Apple Waldorf Salad

This easy Waldorf Salad Recipe is a perfect salad to make in just minutes! Made with apples and grapes for a wonderful fruit salad.

Best Waldorf Salad Recipe
Apple Waldorf Salad
Easy Waldorf Salad
Apple Fruit Salad Recipe
Healthy Fruit Salad
Fruit Salad Recipes
Fruit Salads
Fruits And Vegetables Salad Recipe
Salads
Lorie RuthkoL
Lorie Ruthko saved to food
Crunchy Apple Walnut Salad
Saved from flavormosaic.com

Crunchy Apple Walnut Salad

This Apple Walnut Cranberry Salad includes a Mixed Green Spinach Salad with Green Apples, Dried Cranberries, Walnuts, and Gorgonzola Cheese.

Green Apple Recipes
Apple Salad Recipes
Spinach Salad Recipes
Walnut Recipes
Healthy Salad Recipes
Delicious Salads
Green Salad Recipes
Green Apple Salad
Cranberry Walnut Salad
Joan Biggs
Joan Biggs saved to Salads
An easy fall recipe featuring Honeycrisp apples! It's ready in under 10 minutes. Complete with celery, grapes, pecans, and dried cranberries in a lightly sweetened mayonnaise, this is the BEST Apple Salad. Such a unique and delicious side dish!
Saved from smalltownwoman.com

Apple Salad

9 · An easy and unbelievable tasty eight ingredient Apple Salad with grapes, pecans, and dried cranberries made in less than ten minutes.

Ingredients

Produce
  • • 2 Celery, ribs
  • • 1/2 cup Cranberries, dried
  • • 1 cup Grapes, seedless red
  • • 4 Honeycrisp apples, large
  • • 1 Lemon juiced
Condiments
  • • 1/3 cup Mayonnaise
Baking & Spices
  • • 1 1/2 tbsp Brown sugar
Nuts & Seeds
  • • 1/2 cup Pecans
Healthy Nutrition
Nutrition Recipes
Healthy Eating
Healthy Recipes
Proper Nutrition
Fitness Nutrition
Nutrition Facts
Easy Salads
Delicious Salads
Sue Wheeler
Sue Wheeler saved to Salads!
Classic Waldorf Salad - foodiecrush.com
Saved from foodiecrush.com

Classic Waldorf Salad - foodiecrush.com

Crunchy with crisp apples, celery and toasted nuts, this easy Waldorf salad is a classic recipe perfect for a crowd any time of year.

Christmas Salad Recipes
Christmas Salads
Holiday Recipes
Thanksgiving Salad Recipes
Dinner Recipes
Best Waldorf Salad Recipe
Easy Waldorf Salad
Apple Waldorf Salad
Original Waldorf Salad Recipe
Lynn Bither
Lynn Bither saved to Salad recipes
Apple Walnut Salad • Olive & Mango
Saved from oliveandmango.com

Apple Walnut Salad • Olive & Mango

This Apple Salad with Candied Walnuts and Apple dressing is a delicious apple salad recipe that is perfect for fall and a great all year-round salad and perfect for entertaining too

Ingredients

Meat
  • • 3 slices Bacon, cooked and crumbled
Produce
  • • 2 Apples, red or green
  • • 1/3 cup Cranberries, dried
  • • 1/2 Red onion
  • • 6 cups Salad greens and arugula, mixed
Condiments
  • • 1 Squeeze Lemon juice
Nuts & Seeds
  • • 2 tbsp Pumpkin seeds
Dairy
  • • 1/2 cup Feta or goat cheese
Autumn Salad Recipes
Apple Salad Recipes
Whole Food Recipes
Fall Apple Salad Recipe
Walnut Recipes Healthy
Caramelized Walnuts
Roasted Walnuts
Candied Walnuts For Salad
Diner
Sweet Wall
Sweet Wall saved to Food

Watch popular Apple salad videos

Summertime sweets the Pennsylvania way! With local peaches grown by our neighbors down the road.
Creamy apple salad, with a hint of peanut butter, that’s perfect for Autumn and THM E friendly! It’s low fat and contains the healthy carbs we need to nourish our bodies and slim down. Great as a snack, dessert, or potluck offering. We’re finally into my favorite time of year — Autumn…or Fall, whichever you like to call it. That means cooler days, crunchy leaves, and crisp, ripe apples. | Oh Sweet Mercy @ohsweetmercy #trimhealthymamafallsidedish #trimhealthymamathanksgivignrecipes #ohsweetmercy
A Sheet Pan Chicken Drumsticks with warm farro and apple salad! You will likely have never tried this dish, but that makes it even more fun to try it! With protein from the chicken and vitamins from greens, this dish is a very balanced dish! Ingredients and preparation directions are shown in the video, so just pause the video and take your time! Let us know what you think about this dish! Follow us to see more recipes to help you achieve your goals! :) Recipe by: Self.com #highproteinfoods
Kids lunch box👇🍱 Masala Khichdi Channa Boiled egg with pepper Bananas Orange cream biscuits #indyacookery